Lineage for d2de6c2 (2de6 C:143-384)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582036Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2582202Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 2582280Protein Terminal oxygenase component of carbazole CarAa [143827] (1 species)
  7. 2582281Species Janthinobacterium sp. J3 [TaxId:213804] [143828] (4 PDB entries)
    Uniprot Q84II6 143-384
  8. 2582284Domain d2de6c2: 2de6 C:143-384 [131420]
    Other proteins in same PDB: d2de6a1, d2de6a3, d2de6b1, d2de6b3, d2de6c1, d2de6c3
    automatically matched to 1WW9 A:143-384
    complexed with fe2, fes

Details for d2de6c2

PDB Entry: 2de6 (more details), 1.8 Å

PDB Description: The reduced complex between oxygenase and ferredoxin in carbazole 1,9a-dioxygenase
PDB Compounds: (C:) terminal oxygenase component of carbazole

SCOPe Domain Sequences for d2de6c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2de6c2 d.129.3.3 (C:143-384) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. J3 [TaxId: 213804]}
pplardtppnfldddmeilgknqiiksnwrlavengfdpshiyihkdsilvkdndlalpl
gfapggdrkqqtrvvdddvvgrkgvydligehgvpvfegtiggevvregaygekivandi
siwlpgvlkvnpfpnpdmmqfewyvpidenthyyfqtlgkpcandeerkkyeqefeskwk
pmalegfnnddiwareamvdfyaddkgwvneilfesdeaivawrklasehnqgiqtqahv
sg

SCOPe Domain Coordinates for d2de6c2:

Click to download the PDB-style file with coordinates for d2de6c2.
(The format of our PDB-style files is described here.)

Timeline for d2de6c2: