Lineage for d2de6c1 (2de6 C:1-142)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782956Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1782957Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1783075Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
  6. 1783148Protein Terminal oxygenase component of carbazole CarAa [141184] (1 species)
  7. 1783149Species Janthinobacterium sp. J3 [TaxId:213804] [141185] (4 PDB entries)
    Uniprot Q84II6 1-142
  8. 1783152Domain d2de6c1: 2de6 C:1-142 [131419]
    Other proteins in same PDB: d2de6a2, d2de6b2, d2de6c2
    automatically matched to 1WW9 A:1-142
    complexed with fe2, fes

Details for d2de6c1

PDB Entry: 2de6 (more details), 1.8 Å

PDB Description: The reduced complex between oxygenase and ferredoxin in carbazole 1,9a-dioxygenase
PDB Compounds: (C:) terminal oxygenase component of carbazole

SCOPe Domain Sequences for d2de6c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2de6c1 b.33.1.2 (C:1-142) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. J3 [TaxId: 213804]}
manvdeailkrvkgwapyvdaklgfrnhwypvmfskeinegepktlkllgenllvnridg
klyclkdrclhrgvqlsvkvecktkstitcwyhawtyrwedgvlcdiltnptsaqigrqk
lktypvqeakgcvfiylgdgdp

SCOPe Domain Coordinates for d2de6c1:

Click to download the PDB-style file with coordinates for d2de6c1.
(The format of our PDB-style files is described here.)

Timeline for d2de6c1: