| Class b: All beta proteins [48724] (176 folds) |
| Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
| Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins) |
| Protein Terminal oxygenase component of carbazole CarAa [141184] (1 species) |
| Species Janthinobacterium sp. J3 [TaxId:213804] [141185] (4 PDB entries) Uniprot Q84II6 1-142 |
| Domain d2de5c1: 2de5 C:1-142 [131413] Other proteins in same PDB: d2de5a2, d2de5b2, d2de5c2 automatically matched to 1WW9 A:1-142 complexed with fe2, fes |
PDB Entry: 2de5 (more details), 1.9 Å
SCOPe Domain Sequences for d2de5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2de5c1 b.33.1.2 (C:1-142) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. J3 [TaxId: 213804]}
manvdeailkrvkgwapyvdaklgfrnhwypvmfskeinegepktlkllgenllvnridg
klyclkdrclhrgvqlsvkvecktkstitcwyhawtyrwedgvlcdiltnptsaqigrqk
lktypvqeakgcvfiylgdgdp
Timeline for d2de5c1:
View in 3DDomains from other chains: (mouse over for more information) d2de5a1, d2de5a2, d2de5b1, d2de5b2 |