Lineage for d2de5b2 (2de5 B:143-384)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431002Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1431243Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1431332Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 1431407Protein Terminal oxygenase component of carbazole CarAa [143827] (1 species)
  7. 1431408Species Janthinobacterium sp. J3 [TaxId:213804] [143828] (4 PDB entries)
    Uniprot Q84II6 143-384
  8. 1431413Domain d2de5b2: 2de5 B:143-384 [131412]
    Other proteins in same PDB: d2de5a1, d2de5b1, d2de5c1
    automatically matched to 1WW9 A:143-384
    complexed with fe2, fes

Details for d2de5b2

PDB Entry: 2de5 (more details), 1.9 Å

PDB Description: Crystal structure of the electron transfer complex between oxygenase and ferredoxin in carbazole 1,9a-dioxygenase
PDB Compounds: (B:) terminal oxygenase component of carbazole

SCOPe Domain Sequences for d2de5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2de5b2 d.129.3.3 (B:143-384) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. J3 [TaxId: 213804]}
pplardtppnfldddmeilgknqiiksnwrlavengfdpshiyihkdsilvkdndlalpl
gfapggdrkqqtrvvdddvvgrkgvydligehgvpvfegtiggevvregaygekivandi
siwlpgvlkvnpfpnpdmmqfewyvpidenthyyfqtlgkpcandeerkkyeqefeskwk
pmalegfnnddiwareamvdfyaddkgwvneilfesdeaivawrklasehnqgiqtqahv
sg

SCOPe Domain Coordinates for d2de5b2:

Click to download the PDB-style file with coordinates for d2de5b2.
(The format of our PDB-style files is described here.)

Timeline for d2de5b2: