Lineage for d2de5b2 (2de5 B:143-384)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. Protein Terminal oxygenase component of carbazole CarAa [143827] (1 species)
  7. Species Janthinobacterium sp. J3 [TaxId:213804] [143828] (4 PDB entries)
    Uniprot Q84II6 143-384
  8. Domain d2de5b2: 2de5 B:143-384 [131412]
    Other proteins in same PDB: d2de5a1, d2de5a3, d2de5b1, d2de5b3, d2de5c1, d2de5c3
    automatically matched to 1WW9 A:143-384
    complexed with fe2, fes

Details for d2de5b2

PDB Entry: 2de5 (more details), 1.9 Å

PDB Description: Crystal structure of the electron transfer complex between oxygenase and ferredoxin in carbazole 1,9a-dioxygenase
PDB Compounds: (B:) terminal oxygenase component of carbazole

SCOPe Domain Sequences for d2de5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2de5b2 d.129.3.3 (B:143-384) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. J3 [TaxId: 213804]}
pplardtppnfldddmeilgknqiiksnwrlavengfdpshiyihkdsilvkdndlalpl
gfapggdrkqqtrvvdddvvgrkgvydligehgvpvfegtiggevvregaygekivandi
siwlpgvlkvnpfpnpdmmqfewyvpidenthyyfqtlgkpcandeerkkyeqefeskwk
pmalegfnnddiwareamvdfyaddkgwvneilfesdeaivawrklasehnqgiqtqahv
sg

SCOPe Domain Coordinates for d2de5b2 are not available.

Timeline for d2de5b2:

Domains from same chain:
(mouse over for more information)
d2de5b1, d2de5b3
Domains from other chains:
(mouse over for more information)
d2de5a1, d2de5a2, d2de5a3, d2de5c1, d2de5c2, d2de5c3