Lineage for d2de5b1 (2de5 B:1-142)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053226Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2053227Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2053348Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
  6. 2053421Protein Terminal oxygenase component of carbazole CarAa [141184] (1 species)
  7. 2053422Species Janthinobacterium sp. J3 [TaxId:213804] [141185] (4 PDB entries)
    Uniprot Q84II6 1-142
  8. 2053427Domain d2de5b1: 2de5 B:1-142 [131411]
    Other proteins in same PDB: d2de5a2, d2de5a3, d2de5b2, d2de5b3, d2de5c2, d2de5c3
    automatically matched to 1WW9 A:1-142
    complexed with fe2, fes

Details for d2de5b1

PDB Entry: 2de5 (more details), 1.9 Å

PDB Description: Crystal structure of the electron transfer complex between oxygenase and ferredoxin in carbazole 1,9a-dioxygenase
PDB Compounds: (B:) terminal oxygenase component of carbazole

SCOPe Domain Sequences for d2de5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2de5b1 b.33.1.2 (B:1-142) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. J3 [TaxId: 213804]}
manvdeailkrvkgwapyvdaklgfrnhwypvmfskeinegepktlkllgenllvnridg
klyclkdrclhrgvqlsvkvecktkstitcwyhawtyrwedgvlcdiltnptsaqigrqk
lktypvqeakgcvfiylgdgdp

SCOPe Domain Coordinates for d2de5b1:

Click to download the PDB-style file with coordinates for d2de5b1.
(The format of our PDB-style files is described here.)

Timeline for d2de5b1: