SCOP 1.73: Domain d2de5b1: 2de5 B:1-142

Lineage for d2de5b1 (2de5 B:1-142)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (2 families)

5. Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)

6. Protein Terminal oxygenase component of carbazole CarAa [141184] (1 species)

7. Species Janthinobacterium sp. j3 [TaxId:213804] [141185] (4 PDB entries)

8. Domain d2de5b1: 2de5 B:1-142 [131411]
   Other proteins in same PDB: d2de5a2, d2de5b2, d2de5c2
   automatically matched to 1WW9 A:1-142
   complexed with fe2, fes

Details for d2de5b1

PDB Entry: 2de5, 1.9 Å

PDB Description: Crystal structure of the electron transfer complex between oxygenase and ferredoxin in carbazole 1,9a-dioxygenase

PDB Compounds: (B:) terminal oxygenase component of carbazole

SCOP Domain Sequences for d2de5b1:

Sequence; same for both SEQRES and ATOM records:

>d2de5b1 b.33.1.2 (B:1-142) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. j3 [TaxId: 213804]}
manvdeailkrvkgwapyvdaklgfrnhwypvmfskeinegepktlkllgenllvnridg
klyclkdrclhrgvqlsvkvecktkstitcwyhawtyrwedgvlcdiltnptsaqigrqk
lktypvqeakgcvfiylgdgdp

Timeline for d2de5b1:

• d2de5b1 is new in SCOP 1.73
  
• d2de5b1 appears in SCOP 1.75
  
• d2de5b1 appears in the current release, SCOPe 2.08