Lineage for d2de5a1 (2de5 A:1-142)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309647Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1309648Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1309738Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
  6. 1309813Protein Terminal oxygenase component of carbazole CarAa [141184] (1 species)
  7. 1309814Species Janthinobacterium sp. J3 [TaxId:213804] [141185] (4 PDB entries)
    Uniprot Q84II6 1-142
  8. 1309818Domain d2de5a1: 2de5 A:1-142 [131409]
    Other proteins in same PDB: d2de5a2, d2de5b2, d2de5c2
    automatically matched to 1WW9 A:1-142
    complexed with fe2, fes

Details for d2de5a1

PDB Entry: 2de5 (more details), 1.9 Å

PDB Description: Crystal structure of the electron transfer complex between oxygenase and ferredoxin in carbazole 1,9a-dioxygenase
PDB Compounds: (A:) terminal oxygenase component of carbazole

SCOPe Domain Sequences for d2de5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2de5a1 b.33.1.2 (A:1-142) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. J3 [TaxId: 213804]}
manvdeailkrvkgwapyvdaklgfrnhwypvmfskeinegepktlkllgenllvnridg
klyclkdrclhrgvqlsvkvecktkstitcwyhawtyrwedgvlcdiltnptsaqigrqk
lktypvqeakgcvfiylgdgdp

SCOPe Domain Coordinates for d2de5a1:

Click to download the PDB-style file with coordinates for d2de5a1.
(The format of our PDB-style files is described here.)

Timeline for d2de5a1: