Lineage for d2ddya1 (2ddy A:1-167)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867614Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 867615Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) (S)
  5. 867875Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 868000Protein Matrilysin (MMP-7) [55538] (1 species)
  7. 868001Species Human (Homo sapiens) [TaxId:9606] [55539] (4 PDB entries)
  8. 868006Domain d2ddya1: 2ddy A:1-167 [131408]
    automatically matched to d1mmr__
    complexed with ca, mdw, zn

Details for d2ddya1

PDB Entry: 2ddy (more details)

PDB Description: Solution Structure of Matrilysin (MMP-7) Complexed to Constraint Conformational Sulfonamide Inhibitor
PDB Compounds: (A:) Matrilysin

SCOP Domain Sequences for d2ddya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ddya1 d.92.1.11 (A:1-167) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]}
yslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgtadi
migfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaath
elghslgmghssdpnavmyptygngdpqnfklsqddikgiqklygkr

SCOP Domain Coordinates for d2ddya1:

Click to download the PDB-style file with coordinates for d2ddya1.
(The format of our PDB-style files is described here.)

Timeline for d2ddya1: