Lineage for d2ddya_ (2ddy A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964873Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2964874Protein automated matches [190805] (20 species)
    not a true protein
  7. 2964907Species Human (Homo sapiens) [TaxId:9606] [188286] (69 PDB entries)
  8. 2965040Domain d2ddya_: 2ddy A: [131408]
    automated match to d1c3ia_
    complexed with ca, mdw, zn

Details for d2ddya_

PDB Entry: 2ddy (more details)

PDB Description: solution structure of matrilysin (mmp-7) complexed to constraint conformational sulfonamide inhibitor
PDB Compounds: (A:) Matrilysin

SCOPe Domain Sequences for d2ddya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ddya_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgtadi
migfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaath
elghslgmghssdpnavmyptygngdpqnfklsqddikgiqklygkrsnsrkk

SCOPe Domain Coordinates for d2ddya_:

Click to download the PDB-style file with coordinates for d2ddya_.
(The format of our PDB-style files is described here.)

Timeline for d2ddya_: