Lineage for d2ddsc1 (2dds C:8-305)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735706Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 735707Superfamily d.151.1: DNase I-like [56219] (3 families) (S)
  5. 735766Family d.151.1.3: Sphingomyelin phosphodiesterase-like [143902] (1 protein)
    part of Pfam PF03372
  6. 735767Protein Sphingomyelin phosphodiesterase C [143903] (2 species)
  7. 735768Species Bacillus cereus [TaxId:1396] [143904] (3 PDB entries)
  8. 735775Domain d2ddsc1: 2dds C:8-305 [131404]
    automatically matched to 2DDR A:7-305
    complexed with co

Details for d2ddsc1

PDB Entry: 2dds (more details), 1.8 Å

PDB Description: Crystal structure of sphingomyelinase from Bacillus cereus with cobalt ion
PDB Compounds: (C:) Sphingomyelin phosphodiesterase

SCOP Domain Sequences for d2ddsc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ddsc1 d.151.1.3 (C:8-305) Sphingomyelin phosphodiesterase C {Bacillus cereus [TaxId: 1396]}
dtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdnsasdrllgnl
kkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfakgcgpdn
lsnkgfvytkikkndrfvhvigthlqaedsmcgktspasvrtnqlkeiqdfiknknipnn
eyvliggdmnvnkinaennndseyasmfktlnasvpsytghtatwdattnsiakynfpds
paeyldyiiaskdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypveatism

SCOP Domain Coordinates for d2ddsc1:

Click to download the PDB-style file with coordinates for d2ddsc1.
(The format of our PDB-style files is described here.)

Timeline for d2ddsc1: