![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
![]() | Superfamily d.151.1: DNase I-like [56219] (4 families) ![]() |
![]() | Family d.151.1.3: Sphingomyelin phosphodiesterase-like [143902] (2 proteins) part of Pfam PF03372 |
![]() | Protein automated matches [190598] (1 species) not a true protein |
![]() | Species Bacillus cereus [TaxId:1396] [187614] (4 PDB entries) |
![]() | Domain d2ddsb_: 2dds B: [131403] automated match to d2ddra1 complexed with co |
PDB Entry: 2dds (more details), 1.8 Å
SCOPe Domain Sequences for d2ddsb_:
Sequence, based on SEQRES records: (download)
>d2ddsb_ d.151.1.3 (B:) automated matches {Bacillus cereus [TaxId: 1396]} ndtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdnsasdrllgn lkkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfakgcgpd nlsnkgfvytkikkndrfvhvigthlqaedsmcgktspasvrtnqlkeiqdfiknknipn neyvliggdmnvnkinaennndseyasmfktlnasvpsytghtatwdattnsiakynfpd spaeyldyiiaskdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypveatism
>d2ddsb_ d.151.1.3 (B:) automated matches {Bacillus cereus [TaxId: 1396]} ndtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdnsasdrllgn lkkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfakgclsn kgfvytkikkndrfvhvigthlqaespasvrtnqlkeiqdfiknknipnneyvliggdmn vnkinaennndseyasmfktlnasvpsytghtatwdattnsiakynfpdspaeyldyiia skdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypveatism
Timeline for d2ddsb_: