SCOPe 2.04: Domain d2ddha3: 2ddh A:1-267

Lineage for d2ddha3 (2ddh A:1-267)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.2: acyl-CoA oxidase N-terminal domains [75600] (2 proteins)

6. Protein Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 [75601] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [75602] (2 PDB entries)

8. Domain d2ddha3: 2ddh A:1-267 [131396]
   Other proteins in same PDB: d2ddha1, d2ddha2
   automated match to d1is2a3
   complexed with fad, hxd

Details for d2ddha3

PDB Entry: 2ddh, 2.07 Å

PDB Description: Crystal Structure of Acyl-CoA oxidase complexed with 3-OH-dodecanoate

PDB Compounds: (A:) acyl-CoA oxidase

SCOPe Domain Sequences for d2ddha3:

Sequence, based on SEQRES records:

>d2ddha3 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mnpdlrkerasatfnpelithildgspentrrrreienlilndpdfqhedynfltrsqry
evavkksatmvkkmreygisdpeeimwfknsvhrghpepldlhlgmflptllhqataeqq
erffmpawnleitgtyaqtemghgthlrglettatydpktqefilnsptvtsikwwpggl
gktsnhaivlaqlitqgecyglhafvvpireigthkplpgitvgdigpkfgyeemdngyl
kmdnyriprenmlmkyaqvkpdgtyvk

Sequence, based on observed residues (ATOM records):

>d2ddha3 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mnpdlrkerasatfnpelithildgspentrrrreienlilndpdfqhedynfltrsqry
evavkksatmvkkmreygisdpeeimwfknsvhrghpepldlhlgmflptllqataeqqe
rffmpawnleitgtyaqtemghgthlrglettatydpktqefilnsptvtsikwwpgglg
ktsnhaivlaqlitqgecyglhafvvpireigthkplpgitvgdigpkfgyeemdngylk
mdnyriprenmlmkyaqvkpdgtyvk

Timeline for d2ddha3:

• d2ddha3 first appeared in SCOP 1.73
  
• d2ddha3 appears in SCOPe 2.03
  
• d2ddha3 appears in SCOPe 2.05
  
• d2ddha3 appears in the current release, SCOPe 2.08