![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
![]() | Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
![]() | Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
![]() | Family e.6.1.2: acyl-CoA oxidase N-terminal domains [75600] (2 proteins) |
![]() | Protein Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 [75601] (1 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [75602] (2 PDB entries) |
![]() | Domain d2ddha3: 2ddh A:1-267 [131396] Other proteins in same PDB: d2ddha1, d2ddha2 automatically matched to d1is2a3 complexed with fad, hxd |
PDB Entry: 2ddh (more details), 2.07 Å
SCOP Domain Sequences for d2ddha3:
Sequence, based on SEQRES records: (download)
>d2ddha3 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 {Rat (Rattus norvegicus) [TaxId: 10116]} mnpdlrkerasatfnpelithildgspentrrrreienlilndpdfqhedynfltrsqry evavkksatmvkkmreygisdpeeimwfknsvhrghpepldlhlgmflptllhqataeqq erffmpawnleitgtyaqtemghgthlrglettatydpktqefilnsptvtsikwwpggl gktsnhaivlaqlitqgecyglhafvvpireigthkplpgitvgdigpkfgyeemdngyl kmdnyriprenmlmkyaqvkpdgtyvk
>d2ddha3 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 {Rat (Rattus norvegicus) [TaxId: 10116]} mnpdlrkerasatfnpelithildgspentrrrreienlilndpdfqhedynfltrsqry evavkksatmvkkmreygisdpeeimwfknsvhrghpepldlhlgmflptllqataeqqe rffmpawnleitgtyaqtemghgthlrglettatydpktqefilnsptvtsikwwpgglg ktsnhaivlaqlitqgecyglhafvvpireigthkplpgitvgdigpkfgyeemdngylk mdnyriprenmlmkyaqvkpdgtyvk
Timeline for d2ddha3: