Class a: All alpha proteins [46456] (286 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.2: acyl-CoA oxidase C-terminal domains [74714] (2 proteins) duplication: tandem repeat of this fold |
Protein Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 [74715] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [74716] (2 PDB entries) |
Domain d2ddha2: 2ddh A:475-655 [131395] Other proteins in same PDB: d2ddha3 automated match to d1is2a2 complexed with fad, hxd |
PDB Entry: 2ddh (more details), 2.07 Å
SCOPe Domain Sequences for d2ddha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ddha2 a.29.3.2 (A:475-655) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} vdinsleglteayklraarlveiaaknlqthvshrkskevawnltsvdlvraseahchyv vvkvfsdklpkiqdkavqavlrnlcllyslygisqkggdflegsiitgaqlsqvnarile lltlirpnavalvdafdfkdmtlgsvlgrydgnvyenlfewakksplnktevhesyhkhl k
Timeline for d2ddha2: