SCOPe 2.05: Domain d2ddha2: 2ddh A:475-655

Lineage for d2ddha2 (2ddh A:475-655)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.2: acyl-CoA oxidase C-terminal domains [74714] (2 proteins)
   duplication: tandem repeat of this fold

6. Protein Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 [74715] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [74716] (2 PDB entries)

8. Domain d2ddha2: 2ddh A:475-655 [131395]
   Other proteins in same PDB: d2ddha3
   automated match to d1is2a2
   complexed with fad, hxd

Details for d2ddha2

PDB Entry: 2ddh, 2.07 Å

PDB Description: Crystal Structure of Acyl-CoA oxidase complexed with 3-OH-dodecanoate

PDB Compounds: (A:) acyl-CoA oxidase

SCOPe Domain Sequences for d2ddha2:

Sequence; same for both SEQRES and ATOM records:

>d2ddha2 a.29.3.2 (A:475-655) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vdinsleglteayklraarlveiaaknlqthvshrkskevawnltsvdlvraseahchyv
vvkvfsdklpkiqdkavqavlrnlcllyslygisqkggdflegsiitgaqlsqvnarile
lltlirpnavalvdafdfkdmtlgsvlgrydgnvyenlfewakksplnktevhesyhkhl
k

Timeline for d2ddha2:

• d2ddha2 first appeared in SCOP 1.73
  
• d2ddha2 appears in SCOPe 2.04
  
• d2ddha2 appears in SCOPe 2.06
  
• d2ddha2 appears in the current release, SCOPe 2.08