Lineage for d2ddha2 (2ddh A:475-655)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639849Fold a.29: Bromodomain-like [47363] (10 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 639872Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 639962Family a.29.3.2: acyl-CoA oxidase C-terminal domains [74714] (2 proteins)
    duplication: tandem repeat of this fold
  6. 639969Protein Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 [74715] (1 species)
  7. 639970Species Rat (Rattus norvegicus) [TaxId:10116] [74716] (2 PDB entries)
  8. 639972Domain d2ddha2: 2ddh A:475-655 [131395]
    Other proteins in same PDB: d2ddha3
    automatically matched to d1is2a2
    complexed with fad, hxd

Details for d2ddha2

PDB Entry: 2ddh (more details), 2.07 Å

PDB Description: Crystal Structure of Acyl-CoA oxidase complexed with 3-OH-dodecanoate
PDB Compounds: (A:) acyl-CoA oxidase

SCOP Domain Sequences for d2ddha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ddha2 a.29.3.2 (A:475-655) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]}
vdinsleglteayklraarlveiaaknlqthvshrkskevawnltsvdlvraseahchyv
vvkvfsdklpkiqdkavqavlrnlcllyslygisqkggdflegsiitgaqlsqvnarile
lltlirpnavalvdafdfkdmtlgsvlgrydgnvyenlfewakksplnktevhesyhkhl
k

SCOP Domain Coordinates for d2ddha2:

Click to download the PDB-style file with coordinates for d2ddha2.
(The format of our PDB-style files is described here.)

Timeline for d2ddha2: