Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily) core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542 |
Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) |
Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein) part of PfamB PB000266 |
Protein Spike protein S1 [143589] (1 species) |
Species SARS coronavirus [TaxId:227859] [143590] (6 PDB entries) Uniprot P59594 320-502! Uniprot P59594 321-512! Uniprot P59594 323-502 |
Domain d2dd8s1: 2dd8 S:321-512 [131393] Other proteins in same PDB: d2dd8h1, d2dd8h2, d2dd8l1, d2dd8l2 complexed with nag, po4 |
PDB Entry: 2dd8 (more details), 2.3 Å
SCOPe Domain Sequences for d2dd8s1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dd8s1 d.318.1.1 (S:321-512) Spike protein S1 {SARS coronavirus [TaxId: 227859]} nlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfs nvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynyky rylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvls fellnapatvcg
Timeline for d2dd8s1:
View in 3D Domains from other chains: (mouse over for more information) d2dd8h1, d2dd8h2, d2dd8l1, d2dd8l2 |