Lineage for d2dd8s1 (2dd8 S:321-512)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882461Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
    core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542
  4. 882462Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) (S)
  5. 882463Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein)
    part of PfamB PB000266
  6. 882464Protein Spike protein S1 [143589] (1 species)
  7. 882465Species SARS coronavirus [TaxId:227859] [143590] (5 PDB entries)
    Uniprot P59594 320-502! Uniprot P59594 321-512! Uniprot P59594 323-502
  8. 882468Domain d2dd8s1: 2dd8 S:321-512 [131393]
    Other proteins in same PDB: d2dd8h1, d2dd8h2, d2dd8l1, d2dd8l2
    complexed with nag, po4

Details for d2dd8s1

PDB Entry: 2dd8 (more details), 2.3 Å

PDB Description: crystal structure of sars-cov spike receptor-binding domain complexed with neutralizing antibody
PDB Compounds: (S:) Spike glycoprotein

SCOP Domain Sequences for d2dd8s1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dd8s1 d.318.1.1 (S:321-512) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
nlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfs
nvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynyky
rylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvls
fellnapatvcg

SCOP Domain Coordinates for d2dd8s1:

Click to download the PDB-style file with coordinates for d2dd8s1.
(The format of our PDB-style files is described here.)

Timeline for d2dd8s1: