Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein Xylanase II [49979] (17 species) Partial overlap with common fold and the active sites of the other endoglucanases |
Species Bacillus subtilis [TaxId:1423] [49981] (3 PDB entries) |
Domain d2dcyc1: 2dcy C:1-185 [131390] automatically matched to d1axka2 complexed with dio, tar |
PDB Entry: 2dcy (more details), 1.4 Å
SCOPe Domain Sequences for d2dcyc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dcyc1 b.29.1.11 (C:1-185) Xylanase II {Bacillus subtilis [TaxId: 1423]} astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgss nvtvw
Timeline for d2dcyc1:
View in 3D Domains from other chains: (mouse over for more information) d2dcya1, d2dcyb1, d2dcyd1, d2dcye1 |