SCOP 1.73: Domain d2dcyb1: 2dcy B:1-185

Lineage for d2dcyb1 (2dcy B:1-185)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (16 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus subtilis [TaxId:1423] [49981] (3 PDB entries)

8. Domain d2dcyb1: 2dcy B:1-185 [131389]
   automatically matched to d1axka2
   complexed with dio, tar

Details for d2dcyb1

PDB Entry: 2dcy, 1.4 Å

PDB Description: crystal structure of bacillus subtilis family-11 xylanase

PDB Compounds: (B:) Endo-1,4-beta-xylanase A

SCOP Domain Sequences for d2dcyb1:

Sequence; same for both SEQRES and ATOM records:

>d2dcyb1 b.29.1.11 (B:1-185) Xylanase II {Bacillus subtilis [TaxId: 1423]}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

Timeline for d2dcyb1:

• d2dcyb1 is new in SCOP 1.73
  
• d2dcyb1 appears in SCOP 1.75
  
• d2dcyb1 appears in the current release, SCOPe 2.08, called d2dcyb_