| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
| Protein Xylanase II [49979] (21 species) Partial overlap with common fold and the active sites of the other endoglucanases |
| Species Bacillus subtilis [TaxId:1423] [49981] (3 PDB entries) |
| Domain d2dcya_: 2dcy A: [131388] automated match to d2dcya1 complexed with dio, tar, tla |
PDB Entry: 2dcy (more details), 1.4 Å
SCOPe Domain Sequences for d2dcya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dcya_ b.29.1.11 (A:) Xylanase II {Bacillus subtilis [TaxId: 1423]}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw
Timeline for d2dcya_:
View in 3DDomains from other chains: (mouse over for more information) d2dcyb_, d2dcyc_, d2dcyd_, d2dcye_ |