Lineage for d2dcnf_ (2dcn F:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2154413Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2154414Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2154683Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2154684Protein automated matches [190117] (40 species)
    not a true protein
  7. 2154933Species Sulfolobus tokodaii [TaxId:273063] [186841] (2 PDB entries)
  8. 2154938Domain d2dcnf_: 2dcn F: [131379]
    Other proteins in same PDB: d2dcna1
    automated match to d1v19a_
    complexed with adp, ckp, k, mg

Details for d2dcnf_

PDB Entry: 2dcn (more details), 2.25 Å

PDB Description: crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
PDB Compounds: (F:) hypothetical fructokinase

SCOPe Domain Sequences for d2dcnf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dcnf_ c.72.1.0 (F:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
ietflrem

SCOPe Domain Coordinates for d2dcnf_:

Click to download the PDB-style file with coordinates for d2dcnf_.
(The format of our PDB-style files is described here.)

Timeline for d2dcnf_: