Lineage for d2dcna1 (2dcn A:2-309)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904327Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
    automatically mapped to Pfam PF00294
  6. 2904389Protein Hypothetical fructokinase ST2478 [142714] (1 species)
  7. 2904390Species Sulfolobus tokodaii [TaxId:111955] [142715] (1 PDB entry)
    Uniprot Q96XN9 2-309
  8. 2904391Domain d2dcna1: 2dcn A:2-309 [131374]
    Other proteins in same PDB: d2dcnb_, d2dcnc_, d2dcnd_, d2dcne_, d2dcnf_, d2dcng_, d2dcnh_, d2dcni_, d2dcnj_, d2dcnk_, d2dcnl_
    complexed with adp, ckp, k, mg

Details for d2dcna1

PDB Entry: 2dcn (more details), 2.25 Å

PDB Description: crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
PDB Compounds: (A:) hypothetical fructokinase

SCOPe Domain Sequences for d2dcna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dcna1 c.72.1.1 (A:2-309) Hypothetical fructokinase ST2478 {Sulfolobus tokodaii [TaxId: 111955]}
aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
ietflrem

SCOPe Domain Coordinates for d2dcna1:

Click to download the PDB-style file with coordinates for d2dcna1.
(The format of our PDB-style files is described here.)

Timeline for d2dcna1: