SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2dc9a_ (2dc9 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2154579Family d.3.1.1: Papain-like [54002] (26 protein domains)
  6. 2154920Protein automated matches [190264] (11 species)
    not a true protein
  7. 2154928Species Cow (Bos taurus) [TaxId:9913] [187053] (8 PDB entries)
  8. 2154930Domain d2dc9a_: 2dc9 A: [131368]
    automated match to d1itoa_
    complexed with 74m, gol, po4

Details for d2dc9a_

PDB Entry: 2dc9 (more details), 1.94 Å

PDB Description: X-ray crystal structure analysis of bovine spleen cathepsin B-CA074Me complex
PDB Compounds: (A:) cathepsin b

SCOPe Domain Sequences for d2dc9a_:

Sequence, based on SEQRES records: (download)

>d2dc9a_ d.3.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
lpesfdareqwpncptikeirdqgscgscwafgaveaisdricihsngrvnvevsaedml
tccggecgdgcnggfpsgawnfwtkkglvsgglynshvgcrpysippcehhvngsrppct
gegdtpkcsktcepgyspsykedkhfgcssysvannekeimaeiykngpvegafsvysdf
llyksgvyqhvsgeimgghairilgwgvengtpywlvgnswntdwgdngffkilrgqdhc
gieseivagmpct

Sequence, based on observed residues (ATOM records): (download)

>d2dc9a_ d.3.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
lpesfdareqwpncptikeirdqgscgscwafgaveaisdricihsnvnvevsaedmltc
cggecgdgcnggfpsgawnfwtkkglvsgglynshvgcrpysippcehhvngsrppctge
gdtpkcsktcepgyspsykedkhfgcssysvannekeimaeiykngpvegafsvysdfll
yksgvyqhvsgeimgghairilgwgvengtpywlvgnswntdwgdngffkilrgqdhcgi
eseivagmpct

SCOPe Domain Coordinates for d2dc9a_:

Click to download the PDB-style file with coordinates for d2dc9a_.
(The format of our PDB-style files is described here.)

Timeline for d2dc9a_: