Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (16 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (25 proteins) |
Protein (Pro)cathepsin B [54022] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [54025] (11 PDB entries) |
Domain d2dc7a1: 2dc7 A:1-253 [131366] automatically matched to d1itoa_ complexed with 042, gol, po4 |
PDB Entry: 2dc7 (more details), 1.94 Å
SCOP Domain Sequences for d2dc7a1:
Sequence, based on SEQRES records: (download)
>d2dc7a1 d.3.1.1 (A:1-253) (Pro)cathepsin B {Cow (Bos taurus) [TaxId: 9913]} lpesfdareqwpncptikeirdqgscgscwafgaveaisdricihsngrvnvevsaedml tccggecgdgcnggfpsgawnfwtkkglvsgglynshvgcrpysippcehhvngsrppct gegdtpkcsktcepgyspsykedkhfgcssysvannekeimaeiykngpvegafsvysdf llyksgvyqhvsgeimgghairilgwgvengtpywlvgnswntdwgdngffkilrgqdhc gieseivagmpct
>d2dc7a1 d.3.1.1 (A:1-253) (Pro)cathepsin B {Cow (Bos taurus) [TaxId: 9913]} lpesfdareqwpncptikeirdqgscgscwafgaveaisdricihsnvnvevsaedmltc cggecgdgcnggfpsgawnfwtkkglvsgglynshvgcrpysippcehhvngsrppctge gdtpkcsktcepgyspsykedkhfgcssysvannekeimaeiykngpvegafsvysdfll yksgvyqhvsgeimgghairilgwgvengtpywlvgnswntdwgdngffkilrgqdhcgi eseivagmpct
Timeline for d2dc7a1: