SCOP 1.75: Domain d2dbpa1: 2dbp A:3-272

Lineage for d2dbpa1 (2dbp A:3-272)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Hypothetical protein TTHA1568 [142806] (1 species)
   member of Pfam PF02642 (DUF191)

7. Species Thermus thermophilus [TaxId:274] [142807] (2 PDB entries)
   Uniprot Q5SI12 3-272

8. Domain d2dbpa1: 2dbp A:3-272 [131358]
   automatically matched to 2CZL A:3-272
   complexed with 7pe, na, tla

Details for d2dbpa1

PDB Entry: 2dbp, 1.65 Å

PDB Description: Crystal structure of a conserved hypothetical protein TTHA1568 from Thermus thermophilus HB8

PDB Compounds: (A:) ttha1568

SCOP Domain Sequences for d2dbpa1:

Sequence; same for both SEQRES and ATOM records:

>d2dbpa1 c.94.1.1 (A:3-272) Hypothetical protein TTHA1568 {Thermus thermophilus [TaxId: 274]}
alrlgfspcpndtfifyalvhgrvespvplepvledvetlnrwalegrlpltklsyaaya
qvrdryvalrsggalgrgvgplvvargplqaleglrvavpgrhttayfllslyaqgfvpv
evrydrilpmvaqgeveagliihesrftypryglvqvvdlgawweertglplplgailar
rdlgegliraldeavrrsvayalahpeealdymrahaqelsdeviwahvhtyvnafsldv
geegeravarlfaeaearglaapsprplfv

Timeline for d2dbpa1:

• d2dbpa1 first appeared in SCOP 1.73
  
• d2dbpa1 does not appear in SCOPe 2.01