Lineage for d2dara1 (2dar A:53-84)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035744Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 3035837Protein PDZ and LIM domain protein 5, Enigma [144169] (1 species)
  7. 3035838Species Human (Homo sapiens) [TaxId:9606] [144170] (1 PDB entry)
    Uniprot Q96HC4 400-444! Uniprot Q96HC4 445-476
  8. 3035839Domain d2dara1: 2dar A:53-84 [131355]
    Other proteins in same PDB: d2dara3, d2dara4
    complexed with zn

Details for d2dara1

PDB Entry: 2dar (more details)

PDB Description: solution structure of first lim domain of enigma-like pdz and lim domains protein
PDB Compounds: (A:) PDZ and LIM domain protein 5

SCOPe Domain Sequences for d2dara1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]}
ncahckntmayigfveekgalycelcyekffa

SCOPe Domain Coordinates for d2dara1:

Click to download the PDB-style file with coordinates for d2dara1.
(The format of our PDB-style files is described here.)

Timeline for d2dara1: