Lineage for d2daqa1 (2daq A:8-104)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784697Family b.34.9.2: PWWP domain [69250] (6 proteins)
    includes the C-terminal all-alpha subdomain
  6. 2784731Protein Histone-lysine N-methyltransferase NSD3 [141212] (1 species)
    WHSC1L1
  7. 2784732Species Human (Homo sapiens) [TaxId:9606] [141213] (1 PDB entry)
    Uniprot Q9BZ95 957-1053
  8. 2784733Domain d2daqa1: 2daq A:8-104 [131354]
    Other proteins in same PDB: d2daqa2, d2daqa3

Details for d2daqa1

PDB Entry: 2daq (more details)

PDB Description: solution structure of second pwwp domain of whsc1l1 protein
PDB Compounds: (A:) WHSC1L1 protein, isoform long

SCOPe Domain Sequences for d2daqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2daqa1 b.34.9.2 (A:8-104) Histone-lysine N-methyltransferase NSD3 {Human (Homo sapiens) [TaxId: 9606]}
klhykqivwvklgnyrwwpaeicnprsvplniqglkhdlgdfpvfffgshdyywvhqgrv
fpyvegdksfaegqtsinktfkkaleeaakrfqelka

SCOPe Domain Coordinates for d2daqa1:

Click to download the PDB-style file with coordinates for d2daqa1.
(The format of our PDB-style files is described here.)

Timeline for d2daqa1: