Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.2: PWWP domain [69250] (6 proteins) includes the C-terminal all-alpha subdomain |
Protein Histone-lysine N-methyltransferase NSD3 [141212] (1 species) WHSC1L1 |
Species Human (Homo sapiens) [TaxId:9606] [141213] (1 PDB entry) Uniprot Q9BZ95 957-1053 |
Domain d2daqa1: 2daq A:8-104 [131354] Other proteins in same PDB: d2daqa2, d2daqa3 |
PDB Entry: 2daq (more details)
SCOPe Domain Sequences for d2daqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2daqa1 b.34.9.2 (A:8-104) Histone-lysine N-methyltransferase NSD3 {Human (Homo sapiens) [TaxId: 9606]} klhykqivwvklgnyrwwpaeicnprsvplniqglkhdlgdfpvfffgshdyywvhqgrv fpyvegdksfaegqtsinktfkkaleeaakrfqelka
Timeline for d2daqa1: