| Class g: Small proteins [56992] (100 folds) |
| Fold g.85: HIT/MYND zinc finger-like [144231] (1 superfamily) dimetal(zinc)-bound alpha+beta fold; structural similarity to members of the Cysteine-rich domain fold (57888) |
Superfamily g.85.1: HIT/MYND zinc finger-like [144232] (2 families) ![]() |
| Family g.85.1.1: MYND zinc finger [144233] (4 proteins) Pfam PF01753 |
| Protein Zinc finger MYND domain-containing protein 10, ZMYND10 [144236] (1 species) BLu protein |
| Species Human (Homo sapiens) [TaxId:9606] [144237] (2 PDB entries) Uniprot O75800 354-430! Uniprot O75800 384-440 |
| Domain d2dana1: 2dan A:8-54 [131353] Other proteins in same PDB: d2dana2, d2dana3 complexed with zn |
PDB Entry: 2dan (more details)
SCOPe Domain Sequences for d2dana1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dana1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 10, ZMYND10 {Human (Homo sapiens) [TaxId: 9606]}
leavaperprcaycsaeaskrcsrcqnewyccrecqvkhwekhgktc
Timeline for d2dana1: