Lineage for d2d9ta1 (2d9t A:8-67)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784518Family b.34.9.1: Tudor domain [63749] (9 proteins)
    Pfam PF00567
  6. 2784668Protein Tudor domain-containing protein 3, TDRD3 [141201] (2 species)
  7. 2784673Species Mouse (Mus musculus) [TaxId:10090] [141202] (1 PDB entry)
    Uniprot Q91W18 553-612
  8. 2784674Domain d2d9ta1: 2d9t A:8-67 [131351]
    Other proteins in same PDB: d2d9ta2, d2d9ta3

Details for d2d9ta1

PDB Entry: 2d9t (more details)

PDB Description: solution structure of the tudor domain of tudor domain containing protein 3 from mouse
PDB Compounds: (A:) Tudor domain-containing protein 3

SCOPe Domain Sequences for d2d9ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]}
kvwkpgdecfalywednkfyraevealhssgmtavvkftdygnyeevllsnikpvqteaw

SCOPe Domain Coordinates for d2d9ta1:

Click to download the PDB-style file with coordinates for d2d9ta1.
(The format of our PDB-style files is described here.)

Timeline for d2d9ta1: