Lineage for d2d9ra1 (2d9r A:20-104)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 967295Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
    pseudobarrel; capped on both ends by alpha-helices
  4. 967337Superfamily b.129.2: AF2212/PG0164-like [141694] (2 families) (S)
    six-stranded barrel, topologically similar to the Reductase/isomerase/elongation factor domain fold (50412)
  5. 967338Family b.129.2.1: PG0164-like [141695] (1 protein)
    duplication: comprises two intertwinned beta(2)-alpha-beta structural repeats
  6. 967339Protein Hypothetical protein PG0164 [141696] (1 species)
  7. 967340Species Porphyromonas gingivalis [TaxId:837] [141697] (1 PDB entry)
    Uniprot Q7MXL1 20-104
  8. 967341Domain d2d9ra1: 2d9r A:20-104 [131350]
    complexed with bme, cl

Details for d2d9ra1

PDB Entry: 2d9r (more details), 2.01 Å

PDB Description: Structure of Conserved Protein of Unknown Function PG0164 from Porphyromonas gingivalis [W83]
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d2d9ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d9ra1 b.129.2.1 (A:20-104) Hypothetical protein PG0164 {Porphyromonas gingivalis [TaxId: 837]}
spiefdaiirqvpdmdaayveipfdvktvygkgrvrvnatfdgypytgyivrmglpchil
glrqdirraigkqpgdsvyvtllpl

SCOPe Domain Coordinates for d2d9ra1:

Click to download the PDB-style file with coordinates for d2d9ra1.
(The format of our PDB-style files is described here.)

Timeline for d2d9ra1: