| Class b: All beta proteins [48724] (180 folds) |
| Fold b.129: Double-split beta-barrel [89446] (2 superfamilies) pseudobarrel; capped on both ends by alpha-helices |
Superfamily b.129.2: AF2212/PG0164-like [141694] (2 families) ![]() six-stranded barrel, topologically similar to the Reductase/isomerase/elongation factor domain fold (50412) |
| Family b.129.2.1: PG0164-like [141695] (1 protein) duplication: comprises two intertwinned beta(2)-alpha-beta structural repeats automatically mapped to Pfam PF08922 |
| Protein Hypothetical protein PG0164 [141696] (1 species) |
| Species Porphyromonas gingivalis [TaxId:837] [141697] (1 PDB entry) Uniprot Q7MXL1 20-104 |
| Domain d2d9ra1: 2d9r A:20-104 [131350] complexed with bme, cl |
PDB Entry: 2d9r (more details), 2.01 Å
SCOPe Domain Sequences for d2d9ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d9ra1 b.129.2.1 (A:20-104) Hypothetical protein PG0164 {Porphyromonas gingivalis [TaxId: 837]}
spiefdaiirqvpdmdaayveipfdvktvygkgrvrvnatfdgypytgyivrmglpchil
glrqdirraigkqpgdsvyvtllpl
Timeline for d2d9ra1: