| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [141034] (1 PDB entry) Uniprot Q99062 120-226! Uniprot Q99062 227-331 |
| Domain d2d9qb3: 2d9q B:97-203 [131349] Other proteins in same PDB: d2d9qa_, d2d9qb1 |
PDB Entry: 2d9q (more details), 2.8 Å
SCOPe Domain Sequences for d2d9qb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d9qb3 b.1.2.1 (B:97-203) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]}
gyppaiphnlsclmnlttsslicqwepgpethlptsftlksfksrgncqtqgdsildcvp
kdgqshcsiprkhlllyqnmgiwvqaenalgtsmspqlcldpmdvvk
Timeline for d2d9qb3: