Lineage for d2d9qb3 (2d9q B:97-203)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
    Pfam PF00041
  6. 657384Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (2 species)
  7. 657385Species Human (Homo sapiens) [TaxId:9606] [141034] (1 PDB entry)
  8. 657387Domain d2d9qb3: 2d9q B:97-203 [131349]
    Other proteins in same PDB: d2d9qa1, d2d9qb1
    complexed with nag; mutant

Details for d2d9qb3

PDB Entry: 2d9q (more details), 2.8 Å

PDB Description: crystal structure of the human gcsf-receptor signaling complex
PDB Compounds: (B:) granulocyte colony-stimulating factor receptor

SCOP Domain Sequences for d2d9qb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d9qb3 b.1.2.1 (B:97-203) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]}
gyppaiphnlsclmnlttsslicqwepgpethlptsftlksfksrgncqtqgdsildcvp
kdgqshcsiprkhlllyqnmgiwvqaenalgtsmspqlcldpmdvvk

SCOP Domain Coordinates for d2d9qb3:

Click to download the PDB-style file with coordinates for d2d9qb3.
(The format of our PDB-style files is described here.)

Timeline for d2d9qb3:

View in 3D
Domains from other chains:
(mouse over for more information)
d2d9qa1