Lineage for d2d9qb2 (2d9q B:204-308)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2371913Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (2 species)
  7. 2371914Species Human (Homo sapiens) [TaxId:9606] [141034] (1 PDB entry)
    Uniprot Q99062 120-226! Uniprot Q99062 227-331
  8. 2371915Domain d2d9qb2: 2d9q B:204-308 [131348]
    Other proteins in same PDB: d2d9qa_, d2d9qb1

Details for d2d9qb2

PDB Entry: 2d9q (more details), 2.8 Å

PDB Description: crystal structure of the human gcsf-receptor signaling complex
PDB Compounds: (B:) granulocyte colony-stimulating factor receptor

SCOPe Domain Sequences for d2d9qb2:

Sequence, based on SEQRES records: (download)

>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]}
leppmlrtmdpspeaappqagclqlswepwqpglhinqkcelrhkpqrgeaswalvgplp
lealqyelcgllpataytlqircirwplpghwsdwspslelrtte

Sequence, based on observed residues (ATOM records): (download)

>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]}
leppmlrtmdpqagclqlswepwqpglhinqkcelrhkpqrgeaswalvgplplealqye
lcgllpataytlqircirwplpghwsdwspslelrtte

SCOPe Domain Coordinates for d2d9qb2:

Click to download the PDB-style file with coordinates for d2d9qb2.
(The format of our PDB-style files is described here.)

Timeline for d2d9qb2:

View in 3D
Domains from other chains:
(mouse over for more information)
d2d9qa_