SCOP 1.73: Domain d2d9qb2: 2d9q B:204-308

Lineage for d2d9qb2 (2d9q B:204-308)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141034] (1 PDB entry)

8. Domain d2d9qb2: 2d9q B:204-308 [131348]
   Other proteins in same PDB: d2d9qa1, d2d9qb1
   complexed with nag; mutant

Details for d2d9qb2

PDB Entry: 2d9q, 2.8 Å

PDB Description: crystal structure of the human gcsf-receptor signaling complex

PDB Compounds: (B:) granulocyte colony-stimulating factor receptor

SCOP Domain Sequences for d2d9qb2:

Sequence, based on SEQRES records:

>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]}
leppmlrtmdpspeaappqagclqlswepwqpglhinqkcelrhkpqrgeaswalvgplp
lealqyelcgllpataytlqircirwplpghwsdwspslelrtte

Sequence, based on observed residues (ATOM records):

>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]}
leppmlrtmdpqagclqlswepwqpglhinqkcelrhkpqrgeaswalvgplplealqye
lcgllpataytlqircirwplpghwsdwspslelrtte

Timeline for d2d9qb2:

• d2d9qb2 is new in SCOP 1.73
  
• d2d9qb2 appears in SCOP 1.75
  
• d2d9qb2 appears in the current release, SCOPe 2.08