Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.3: C2 set domains [49142] (8 proteins) |
Protein Granulocyte colony-stimulating factor (GC-SF) receptor, N-terminal domain [141010] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141011] (1 PDB entry) Uniprot Q99062 26-119 |
Domain d2d9qb1: 2d9q B:3-96 [131347] Other proteins in same PDB: d2d9qa1, d2d9qb2, d2d9qb3 complexed with nag; mutant |
PDB Entry: 2d9q (more details), 2.8 Å
SCOP Domain Sequences for d2d9qb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d9qb1 b.1.1.3 (B:3-96) Granulocyte colony-stimulating factor (GC-SF) receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} cghisvsapivhlgdpitasciikqncshldpepqilwrlgaelqpggrqqrlsdgtqes iitlphlnhtqaflscslnwgnslqildqvelra
Timeline for d2d9qb1: