Lineage for d2d9qb1 (2d9q B:3-96)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 786974Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 787029Protein Granulocyte colony-stimulating factor (GC-SF) receptor, N-terminal domain [141010] (1 species)
  7. 787030Species Human (Homo sapiens) [TaxId:9606] [141011] (1 PDB entry)
    Uniprot Q99062 26-119
  8. 787031Domain d2d9qb1: 2d9q B:3-96 [131347]
    Other proteins in same PDB: d2d9qa1, d2d9qb2, d2d9qb3
    complexed with nag; mutant

Details for d2d9qb1

PDB Entry: 2d9q (more details), 2.8 Å

PDB Description: crystal structure of the human gcsf-receptor signaling complex
PDB Compounds: (B:) granulocyte colony-stimulating factor receptor

SCOP Domain Sequences for d2d9qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d9qb1 b.1.1.3 (B:3-96) Granulocyte colony-stimulating factor (GC-SF) receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
cghisvsapivhlgdpitasciikqncshldpepqilwrlgaelqpggrqqrlsdgtqes
iitlphlnhtqaflscslnwgnslqildqvelra

SCOP Domain Coordinates for d2d9qb1:

Click to download the PDB-style file with coordinates for d2d9qb1.
(The format of our PDB-style files is described here.)

Timeline for d2d9qb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2d9qa1