Class a: All alpha proteins [46456] (289 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
Protein automated matches [190263] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187052] (12 PDB entries) |
Domain d2d9qa_: 2d9q A: [131346] Other proteins in same PDB: d2d9qb1, d2d9qb2, d2d9qb3 automated match to d1gnc__ |
PDB Entry: 2d9q (more details), 2.8 Å
SCOPe Domain Sequences for d2d9qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d9qa_ a.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplsscps qalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmeelgm apalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp
Timeline for d2d9qa_: