SCOPe 2.06: Domain d2d9qa_: 2d9q A:

Lineage for d2d9qa_ (2d9q A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein automated matches [190263] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187052] (12 PDB entries)

8. Domain d2d9qa_: 2d9q A: [131346]
   Other proteins in same PDB: d2d9qb1, d2d9qb2, d2d9qb3
   automated match to d1gnc__

Details for d2d9qa_

PDB Entry: 2d9q, 2.8 Å

PDB Description: crystal structure of the human gcsf-receptor signaling complex

PDB Compounds: (A:) csf3

SCOPe Domain Sequences for d2d9qa_:

Sequence; same for both SEQRES and ATOM records:

>d2d9qa_ a.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplsscps
qalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmeelgm
apalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp

Timeline for d2d9qa_:

• d2d9qa_ first appeared in SCOP 1.73, called d2d9qa1
  
• d2d9qa_ appears in SCOPe 2.05
  
• d2d9qa_ appears in SCOPe 2.07
  
• d2d9qa_ appears in the current release, SCOPe 2.08