![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) ![]() |
![]() | Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins) |
![]() | Protein Xylanase II [49979] (17 species) Partial overlap with common fold and the active sites of the other endoglucanases |
![]() | Species Trichoderma reesei, xynII [TaxId:51453] [49985] (10 PDB entries) |
![]() | Domain d2d97a1: 2d97 A:2-190 [131344] automatically matched to d1enxa_ complexed with tyi |
PDB Entry: 2d97 (more details), 2.01 Å
SCOP Domain Sequences for d2d97a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d97a1 b.29.1.11 (A:2-190) Xylanase II {Trichoderma reesei, xynII [TaxId: 51453]} tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs sgsasitvs
Timeline for d2d97a1: