SCOP 1.75: Domain d2d97a1: 2d97 A:2-190

Lineage for d2d97a1 (2d97 A:2-190)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (17 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Trichoderma reesei, xynII [TaxId:51453] [49985] (10 PDB entries)

8. Domain d2d97a1: 2d97 A:2-190 [131344]
   automatically matched to d1enxa_
   complexed with tyi

Details for d2d97a1

PDB Entry: 2d97, 2.01 Å

PDB Description: Structure of VIL-xylanase

PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOP Domain Sequences for d2d97a1:

Sequence; same for both SEQRES and ATOM records:

>d2d97a1 b.29.1.11 (A:2-190) Xylanase II {Trichoderma reesei, xynII [TaxId: 51453]}
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
sgsasitvs

Timeline for d2d97a1:

• d2d97a1 first appeared in SCOP 1.73
  
• d2d97a1 is called d2d97a_ in SCOPe 2.01
  
• d2d97a1 appears in the current release, SCOPe 2.08, called d2d97a_