Lineage for d2d8ya2 (2d8y A:44-85)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640448Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 2640482Protein Eplin, LIMA1 [144165] (1 species)
    Epithelial protein lost in neoplasm
  7. 2640483Species Human (Homo sapiens) [TaxId:9606] [144166] (1 PDB entry)
    Uniprot Q9UHB6 381-417! Uniprot Q9UHB6 416-457
  8. 2640485Domain d2d8ya2: 2d8y A:44-85 [131340]
    Other proteins in same PDB: d2d8ya3, d2d8ya4
    complexed with zn

Details for d2d8ya2

PDB Entry: 2d8y (more details)

PDB Description: solution structure of the lim domain of epithelial protein lost in neoplasm
PDB Compounds: (A:) EPLIN protein

SCOPe Domain Sequences for d2d8ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]}
rcsycnnklslgtyaslhgriyckphfnqlfkskgnydegfg

SCOPe Domain Coordinates for d2d8ya2:

Click to download the PDB-style file with coordinates for d2d8ya2.
(The format of our PDB-style files is described here.)

Timeline for d2d8ya2: