SCOP 1.75: Domain d2d8ya2: 2d8y A:44-85

Lineage for d2d8ya2 (2d8y A:44-85)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families)

5. Family g.39.1.3: LIM domain [57736] (18 proteins)
   duplication: contains two (sub)domains of this fold

6. Protein Eplin, LIMA1 [144165] (1 species)
   Epithelial protein lost in neoplasm

7. Species Human (Homo sapiens) [TaxId:9606] [144166] (1 PDB entry)
   Uniprot Q9UHB6 381-417! Uniprot Q9UHB6 416-457

8. Domain d2d8ya2: 2d8y A:44-85 [131340]
   complexed with zn

Details for d2d8ya2

PDB Entry: 2d8y

PDB Description: solution structure of the lim domain of epithelial protein lost in neoplasm

PDB Compounds: (A:) EPLIN protein

SCOP Domain Sequences for d2d8ya2:

Sequence; same for both SEQRES and ATOM records:

>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]}
rcsycnnklslgtyaslhgriyckphfnqlfkskgnydegfg

Timeline for d2d8ya2:

• d2d8ya2 first appeared in SCOP 1.73
  
• d2d8ya2 appears in SCOPe 2.01
  
• d2d8ya2 appears in the current release, SCOPe 2.08