SCOPe 2.08: Domain d2d8wa_: 2d8w A:

Lineage for d2d8wa_ (2d8w A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (500 PDB entries)
   Uniprot P00760

8. Domain d2d8wa_: 2d8w A: [131336]
   automated match to d1aq7__
   complexed with ca, iod

Details for d2d8wa_

PDB Entry: 2d8w, 2 Å

PDB Description: Structure of HYPER-VIL-trypsin

PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d2d8wa_:

Sequence; same for both SEQRES and ATOM records:

>d2d8wa_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d2d8wa_:

• d2d8wa_ first appeared in SCOP 1.73, called d2d8wa1
  
• d2d8wa_ appears in SCOPe 2.07