![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.85: HIT/MYND zinc finger-like [144231] (1 superfamily) dimetal(zinc)-bound alpha+beta fold; structural similarity to members of the Cysteine-rich domain fold (57888) |
![]() | Superfamily g.85.1: HIT/MYND zinc finger-like [144232] (2 families) ![]() |
![]() | Family g.85.1.1: MYND zinc finger [144233] (4 proteins) Pfam PF01753 |
![]() | Protein Zinc finger MYND domain-containing protein 10, ZMYND10 [144236] (1 species) BLu protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [144237] (2 PDB entries) Uniprot O75800 354-430! Uniprot O75800 384-440 |
![]() | Domain d2d8qa1: 2d8q A:8-64 [131335] Other proteins in same PDB: d2d8qa2, d2d8qa3 complexed with zn |
PDB Entry: 2d8q (more details)
SCOPe Domain Sequences for d2d8qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d8qa1 g.85.1.1 (A:8-64) Zinc finger MYND domain-containing protein 10, ZMYND10 {Human (Homo sapiens) [TaxId: 9606]} leavaperprcaycsaeaskrcsrcqnewyccrecqvkhwekhgktcvlaaqgdrak
Timeline for d2d8qa1: