Lineage for d2d8qa1 (2d8q A:8-64)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643444Fold g.85: HIT/MYND zinc finger-like [144231] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold; structural similarity to members of the Cysteine-rich domain fold (57888)
  4. 2643445Superfamily g.85.1: HIT/MYND zinc finger-like [144232] (2 families) (S)
  5. 2643446Family g.85.1.1: MYND zinc finger [144233] (4 proteins)
    Pfam PF01753
  6. 2643451Protein Zinc finger MYND domain-containing protein 10, ZMYND10 [144236] (1 species)
    BLu protein
  7. 2643452Species Human (Homo sapiens) [TaxId:9606] [144237] (2 PDB entries)
    Uniprot O75800 354-430! Uniprot O75800 384-440
  8. 2643454Domain d2d8qa1: 2d8q A:8-64 [131335]
    Other proteins in same PDB: d2d8qa2, d2d8qa3
    complexed with zn

Details for d2d8qa1

PDB Entry: 2d8q (more details)

PDB Description: solution structure of the mynd domain of the human zinc finger mynd domain-containing protein 10
PDB Compounds: (A:) Zinc finger MYND domain containing protein 10

SCOPe Domain Sequences for d2d8qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d8qa1 g.85.1.1 (A:8-64) Zinc finger MYND domain-containing protein 10, ZMYND10 {Human (Homo sapiens) [TaxId: 9606]}
leavaperprcaycsaeaskrcsrcqnewyccrecqvkhwekhgktcvlaaqgdrak

SCOPe Domain Coordinates for d2d8qa1:

Click to download the PDB-style file with coordinates for d2d8qa1.
(The format of our PDB-style files is described here.)

Timeline for d2d8qa1: