Lineage for d2d8pa_ (2d8p A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777878Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2777879Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2777880Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. 2778007Protein automated matches [190195] (6 species)
    not a true protein
  7. 2778020Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [186982] (31 PDB entries)
  8. 2778048Domain d2d8pa_: 2d8p A: [131334]
    automated match to d1kwna_
    complexed with iod

Details for d2d8pa_

PDB Entry: 2d8p (more details), 2.3 Å

PDB Description: Structure of HYPER-VIL-thaumatin
PDB Compounds: (A:) thaumatin I

SCOPe Domain Sequences for d2d8pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d8pa_ b.25.1.1 (A:) automated matches {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d2d8pa_:

Click to download the PDB-style file with coordinates for d2d8pa_.
(The format of our PDB-style files is described here.)

Timeline for d2d8pa_: