Lineage for d2d8la_ (2d8l A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2007005Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2007006Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2007174Family a.102.1.6: Hypothetical protein YteR [89108] (2 proteins)
    unknown function; weak sequence similarity to the catalytic domain of cellulases
    automatically mapped to Pfam PF07470
  6. 2007179Protein automated matches [190262] (1 species)
    not a true protein
  7. 2007180Species Bacillus subtilis [TaxId:1423] [187051] (1 PDB entry)
  8. 2007181Domain d2d8la_: 2d8l A: [131332]
    automated match to d1nc5a_
    complexed with ucd

Details for d2d8la_

PDB Entry: 2d8l (more details), 1.7 Å

PDB Description: crystal structure of unsaturated rhamnogalacturonyl hydrolase in complex with dglca-galnac
PDB Compounds: (A:) Putative glycosyl hydrolase yteR

SCOPe Domain Sequences for d2d8la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d8la_ a.102.1.6 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
kspltyaealantimntytveelppanrwhyhqgvflcgvlrlweatgekryfeyakaya
dlliddngnllfrrdeldaiqaglilfplyeqtkderyvkaakrlrslygtlnrtseggf
whkdgypyqmwldglymggpfalkyanlkqetelfdqvvlqeslmrkhtkdaktglfyha
wdeakkmpwaneetgcspefwarsigwyvmsladmieelpkkhpnrhvwkntlqdmiksi
cryqdketglwyqivdkgdrsdnwlessgsclymyaiakginkgyldrayettllkayqg
liqhktetsedgaflvkdicvgtsagfydyyvsrerstndlhgagafilamteleplfrs
agk

SCOPe Domain Coordinates for d2d8la_:

Click to download the PDB-style file with coordinates for d2d8la_.
(The format of our PDB-style files is described here.)

Timeline for d2d8la_: