Lineage for d2d8la1 (2d8l A:11-373)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645795Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 645796Superfamily a.102.1: Six-hairpin glycosidases [48208] (7 families) (S)
  5. 645931Family a.102.1.6: Hypothetical protein YteR [89108] (1 protein)
    unknown function; weak sequence similarity to the catalytic domain of cellulases
  6. 645932Protein Hypothetical protein YteR [89109] (1 species)
  7. 645933Species Bacillus subtilis [TaxId:1423] [89110] (2 PDB entries)
  8. 645935Domain d2d8la1: 2d8l A:11-373 [131332]
    automatically matched to d1nc5a_
    complexed with ucd

Details for d2d8la1

PDB Entry: 2d8l (more details), 1.7 Å

PDB Description: crystal structure of unsaturated rhamnogalacturonyl hydrolase in complex with dglca-galnac
PDB Compounds: (A:) Putative glycosyl hydrolase yteR

SCOP Domain Sequences for d2d8la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d8la1 a.102.1.6 (A:11-373) Hypothetical protein YteR {Bacillus subtilis [TaxId: 1423]}
kspltyaealantimntytveelppanrwhyhqgvflcgvlrlweatgekryfeyakaya
dlliddngnllfrrdeldaiqaglilfplyeqtkderyvkaakrlrslygtlnrtseggf
whkdgypyqmwldglymggpfalkyanlkqetelfdqvvlqeslmrkhtkdaktglfyha
wdeakkmpwaneetgcspefwarsigwyvmsladmieelpkkhpnrhvwkntlqdmiksi
cryqdketglwyqivdkgdrsdnwlessgsclymyaiakginkgyldrayettllkayqg
liqhktetsedgaflvkdicvgtsagfydyyvsrerstndlhgagafilamteleplfrs
agk

SCOP Domain Coordinates for d2d8la1:

Click to download the PDB-style file with coordinates for d2d8la1.
(The format of our PDB-style files is described here.)

Timeline for d2d8la1: