Lineage for d2d8ea_ (2d8e A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732498Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2732499Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2732500Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
    intertwined homodimer of 3-helical subunits
  6. 2732501Protein Chorismate mutase domain of P-protein [48602] (2 species)
  7. 2732505Species Thermus thermophilus [TaxId:274] [140937] (2 PDB entries)
    Uniprot Q5SLA5 3-82
  8. 2732508Domain d2d8ea_: 2d8e A: [131331]
    automated match to d2d8da1

Details for d2d8ea_

PDB Entry: 2d8e (more details), 1.75 Å

PDB Description: Structure of Chorismate Mutase (Form II) from Thermus Thermophilus HB8
PDB Compounds: (A:) phospho-2-dehydro-3-deoxyheptonate aldolase/chorismate mutase

SCOPe Domain Sequences for d2d8ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d8ea_ a.130.1.1 (A:) Chorismate mutase domain of P-protein {Thermus thermophilus [TaxId: 274]}
eriqalrkevdrvnreilrllsergrlvqeigrlqtelglphydpkreeemlayltaenp
gpfpdetirklfkeifkasldleerqdq

SCOPe Domain Coordinates for d2d8ea_:

Click to download the PDB-style file with coordinates for d2d8ea_.
(The format of our PDB-style files is described here.)

Timeline for d2d8ea_: