Lineage for d2d8db1 (2d8d B:3-82)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777702Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 777703Superfamily a.130.1: Chorismate mutase II [48600] (4 families) (S)
  5. 777704Family a.130.1.1: Dimeric chorismate mutase [48601] (3 proteins)
    intertwined homodimer of 3-helical subunits
  6. 777705Protein Chorismate mutase domain of P-protein [48602] (2 species)
  7. 777709Species Thermus thermophilus [TaxId:274] [140937] (2 PDB entries)
    Uniprot Q5SLA5 3-82
  8. 777711Domain d2d8db1: 2d8d B:3-82 [131330]
    automatically matched to 2D8D A:3-82
    complexed with cl

Details for d2d8db1

PDB Entry: 2d8d (more details), 1.15 Å

PDB Description: Structure of Chorismate Mutase (Form I) from Thermus Thermophilus HB8
PDB Compounds: (B:) phospho-2-dehydro-3-deoxyheptonate aldolase/chorismate mutase

SCOP Domain Sequences for d2d8db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d8db1 a.130.1.1 (B:3-82) Chorismate mutase domain of P-protein {Thermus thermophilus [TaxId: 274]}
eriqalrkevdrvnreilrllsergrlvqeigrlqtelglphydpkreeemlayltaenp
gpfpdetirklfkeifkasl

SCOP Domain Coordinates for d2d8db1:

Click to download the PDB-style file with coordinates for d2d8db1.
(The format of our PDB-style files is described here.)

Timeline for d2d8db1: