SCOP 1.73: Domain d2d8db1: 2d8d B:3-82

Lineage for d2d8db1 (2d8d B:3-82)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
   multihelical; core: 6 helices, bundle

4. Superfamily a.130.1: Chorismate mutase II [48600] (4 families)

5. Family a.130.1.1: Dimeric chorismate mutase [48601] (3 proteins)
   intertwined homodimer of 3-helical subunits

6. Protein Chorismate mutase domain of P-protein [48602] (2 species)

7. Species Thermus thermophilus [TaxId:274] [140937] (2 PDB entries)

8. Domain d2d8db1: 2d8d B:3-82 [131330]
   automatically matched to 2D8D A:3-82
   complexed with cl

Details for d2d8db1

PDB Entry: 2d8d, 1.15 Å

PDB Description: Structure of Chorismate Mutase (Form I) from Thermus Thermophilus HB8

PDB Compounds: (B:) phospho-2-dehydro-3-deoxyheptonate aldolase/chorismate mutase

SCOP Domain Sequences for d2d8db1:

Sequence; same for both SEQRES and ATOM records:

>d2d8db1 a.130.1.1 (B:3-82) Chorismate mutase domain of P-protein {Thermus thermophilus [TaxId: 274]}
eriqalrkevdrvnreilrllsergrlvqeigrlqtelglphydpkreeemlayltaenp
gpfpdetirklfkeifkasl

Timeline for d2d8db1:

• d2d8db1 is new in SCOP 1.73
  
• d2d8db1 appears in SCOP 1.75
  
• d2d8db1 appears in the current release, SCOPe 2.08, called d2d8db_