Lineage for d2d8db_ (2d8d B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338437Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2338438Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2338439Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
    intertwined homodimer of 3-helical subunits
  6. 2338440Protein Chorismate mutase domain of P-protein [48602] (2 species)
  7. 2338444Species Thermus thermophilus [TaxId:274] [140937] (2 PDB entries)
    Uniprot Q5SLA5 3-82
  8. 2338446Domain d2d8db_: 2d8d B: [131330]
    automated match to d2d8da1
    complexed with cl

Details for d2d8db_

PDB Entry: 2d8d (more details), 1.15 Å

PDB Description: Structure of Chorismate Mutase (Form I) from Thermus Thermophilus HB8
PDB Compounds: (B:) phospho-2-dehydro-3-deoxyheptonate aldolase/chorismate mutase

SCOPe Domain Sequences for d2d8db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d8db_ a.130.1.1 (B:) Chorismate mutase domain of P-protein {Thermus thermophilus [TaxId: 274]}
eriqalrkevdrvnreilrllsergrlvqeigrlqtelglphydpkreeemlayltaenp
gpfpdetirklfkeifkasldle

SCOPe Domain Coordinates for d2d8db_:

Click to download the PDB-style file with coordinates for d2d8db_.
(The format of our PDB-style files is described here.)

Timeline for d2d8db_: