SCOPe 2.08: Domain d2d8db_: 2d8d B:

Lineage for d2d8db_ (2d8d B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
   multihelical; core: 6 helices, bundle

4. Superfamily a.130.1: Chorismate mutase II [48600] (5 families)

5. Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
   intertwined homodimer of 3-helical subunits

6. Protein Chorismate mutase domain of P-protein [48602] (2 species)

7. Species Thermus thermophilus [TaxId:274] [140937] (2 PDB entries)
   Uniprot Q5SLA5 3-82

8. Domain d2d8db_: 2d8d B: [131330]
   automated match to d2d8da1
   complexed with cl

Details for d2d8db_

PDB Entry: 2d8d, 1.15 Å

PDB Description: Structure of Chorismate Mutase (Form I) from Thermus Thermophilus HB8

PDB Compounds: (B:) phospho-2-dehydro-3-deoxyheptonate aldolase/chorismate mutase

SCOPe Domain Sequences for d2d8db_:

Sequence; same for both SEQRES and ATOM records:

>d2d8db_ a.130.1.1 (B:) Chorismate mutase domain of P-protein {Thermus thermophilus [TaxId: 274]}
eriqalrkevdrvnreilrllsergrlvqeigrlqtelglphydpkreeemlayltaenp
gpfpdetirklfkeifkasldle

Timeline for d2d8db_:

• d2d8db_ first appeared in SCOP 1.73, called d2d8db1
  
• d2d8db_ appears in SCOPe 2.07